Overview

  • Product name

    Anti-Interferon alpha 1 antibody
    See all Interferon alpha 1 primary antibodies
  • Description

    Rabbit polyclonal to Interferon alpha 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Interferon alpha 1 aa 63-108.
    Sequence:

    QEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKF


    Database link: P01562

  • Positive control

    • WB: HEK-293T, NIH/3T3 and H9c2 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab191903 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Detects a band of approximately 24 kDa (predicted molecular weight: 22 kDa).

Target

Images

  • All lanes : Anti-Interferon alpha 1 antibody (ab191903)

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : NIH/3T3 (Mouse embryo fibroblast cell line) whole cell lysate
    Lane 3 : H9c2 (Rat heart myoblast cell line) whole cell lysate

    Predicted band size: 22 kDa

References

ab191903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up