Overview

  • Product name

    Anti-Interferon alpha 2 antibody
    See all Interferon alpha 2 primary antibodies
  • Description

    Rabbit polyclonal to Interferon alpha 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Interferon alpha 2 aa 24-188.
    Sequence:

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA ETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVI QGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKE


    Database link: P01563

  • Positive control

    • WB: Mouse liver and mouse stomach tissue lysates. IHC-P: Human glioma, human lung and human kidney lysates. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 22 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Produced by macrophages, IFN-alpha have antiviral activities.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha 2a interferon antibody
    • IFN alpha 2 antibody
    • IFN alphaA antibody
    • IFN-alpha-2 antibody
    • IFNA antibody
    • Ifna2 antibody
    • IFNA2_HUMAN antibody
    • IFNA2B antibody
    • INFA2 antibody
    • Interferon alpha 2a antibody
    • Interferon alpha 2b antibody
    • Interferon alpha A antibody
    • Interferon alpha-2 antibody
    • Interferon alpha-A antibody
    • Interferon antibody
    • LeIF A antibody
    • LeIFA antibody
    • MGC125764 antibody
    • MGC125765 antibody
    see all

Images

  • Anti-Interferon alpha 2 antibody (ab193055) at 2 µg/ml + Mouse liver tissue lysate

    Secondary
    Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 22 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling Interferon alpha 2 with ab193055 at a dilution of 1/100.

  • Immunocytochemistry/ Immunofluorescence analysis of HeLa (Human epithelial cells from cervix adenocarcinoma cell line) cells labeling Interferon alpha 2 with ab193055 at 1/100 dilution. The nuclear counterstain is DAPI (blue).

  • Anti-Interferon alpha 2 antibody (ab193055) at 3 µg/ml + Mouse stomach tissue

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labeling Interferon alpha 2 with ab193055 at 1/100 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human glioma tissue labelling Interferon alpha 2 with ab193055 at a dilution of 1/100.

References

This product has been referenced in:

  • Marcial GE  et al. Lactobacillus johnsonii N6.2 Modulates the Host Immune Responses: A Double-Blind, Randomized Trial in Healthy Adults. Front Immunol 8:655 (2017). Read more (PubMed: 28659913) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up