Overview

  • Product name

    Anti-Interferon alpha10 antibody
    See all Interferon alpha10 primary antibodies
  • Description

    Rabbit polyclonal to Interferon alpha10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Interferon alpha10 aa 24-189. Full length mature protein without the signal peptide
    Sequence:

    CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQK AQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACV IQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMR SLSFSTNLQKRLRRKD


    Database link: P01566

  • Positive control

    • WB: Mouse kidney tissue lysate. IHC-P: Mouse kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IFN-alpha-10 antibody
    • IFN10_HUMAN antibody
    • IFNA10 antibody
    • Interferon alpha 6L antibody
    • Interferon alpha C antibody
    • Interferon alpha-10 antibody
    • Interferon alpha-6L antibody
    • Interferon alpha-C antibody
    • interferon, alpha 10 antibody
    • LeIF C antibody
    • MGC119878 antibody
    • MGC119879 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Interferon alpha10 using ab236586 at 1/100 dilution in immunohistochemical analysis.

  • Anti-Interferon alpha10 antibody (ab236586) at 1/200 dilution + Mouse kidney tissue

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

References

ab236586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up