Overview

  • Product name
    Anti-Interferon beta antibody - C-terminal
    See all Interferon beta primary antibodies
  • Description
    Rabbit polyclonal to Interferon beta - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Sandwich ELISA, WB, IHC-P, Neutralisingmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Interferon beta aa 22-187 (C terminal).
    Sequence:

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI LRNFYFINRLTGYLRN


    Database link: P01574

  • Positive control
    • Human normal placenta tissue; recombinant Human Interferon beta protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab186669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use a concentration of 0.5 - 2 µg/ml.

Can be used as a capture antibody, with ab84258 as a detection antibody

WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 0.75 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Neutralising Use a concentration of 2.5 µg/ml.

At the recommended concentration ab186669 yields one-half maximal inhibition [ND50] of the biological activity of Human Interferon beta (5 μg/ml).

Target

  • Function
    Has antiviral, antibacterial and anticancer activities.
  • Sequence similarities
    Belongs to the alpha/beta interferon family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • beta-interferon antibody
    • Fibroblast interferon antibody
    • IFB antibody
    • IFF antibody
    • IFN beta antibody
    • IFN-beta antibody
    • IFNB 1 antibody
    • IFNB antibody
    • IFNB_HUMAN antibody
    • IFNB1 antibody
    • Interferon beta 1 fibroblast antibody
    • Interferon beta antibody
    • Interferon beta precursor antibody
    • MGC96956 antibody
    see all

Images

  • ab186669 was used for Western blot  at a concentration of 0.1-0.2 µg/ml, and the detection limit for recombinant Human Interferon beta is 1.5-3.0 ng/lane when used in conjunction with compatible secondary reagents.

  • ab186669 was used for Western blot at a concentration of 0.1-0.2 µg/ml, and the detection limit for recombinant Human Interferon beta is 1.5-3.0 ng/lane when used in conjunction with compatible secondary reagents.

  • ab186669 was used at a concentration of 0.5-2.0 µg/ml for Sandwich ELISA analysis, and the detection limit for recombinant Human Interferon beta is 1.5-3.0 ng/lane when used in conjunction with compatible secondary reagents.

References

This product has been referenced in:
  • Liu Y  et al. Suppression of mRNA Nanoparticle Transfection in Human Fibroblasts by Selected Interferon Inhibiting Small Molecule Compounds. Biomolecules 7:N/A (2017). Read more (PubMed: 28758979) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up