Anti-Interferon gamma antibody (ab9657)

Rabbit polyclonal Interferon gamma antibody. Validated in WB, IHC, Neut, ICC/IF, sELISA and tested in Mouse, Human, Macaque monkey. Cited in 33 publication(s). Independently reviewed in 6 review(s).

Overview

  • Product name

    Anti-Interferon gamma antibody
    See all Interferon gamma primary antibodies
  • Description

    Rabbit polyclonal to Interferon gamma
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Sandwich ELISA, WB, Neutralising, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Macaque monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Interferon gamma. Mature Interferon gamma is from aa 24-161 of SwissProt ID Q14609. aa 1-23 represents the signal peptide.
    Sequence:

    MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQI VSFYFKLFKN FKDDQSIQKS VETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR KRSQMLFQGR RASQ


    Database link: Q14609

  • Positive control

Properties

Applications

Our Abpromise guarantee covers the use of ab9657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use at an assay dependent concentration.

To detect IFN-gamma by sandwich ELISA (using 100µl/well antibody solution) a concentration of at least 0.5µg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with compatible secondary reagents, allows the detection of 0.2 - 0.4 ng/well of recombinant hIFN-gamma.

Can be paired for ELISA with ab9658.

WB Use at an assay dependent concentration. To detect hIFN-gamma by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant hIFN-gamma is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Neutralising Use at an assay dependent concentration. To yield one-half maximal inhibition [ND50] of the biological activity of hIFN-gamma (50 pg/ml), a concentration of 0.04 - 0.06 ng/ml of this antibody is required.
ICC/IF 1/50.
IHC-P Use a concentration of 0.25 - 0.5 µg/ml.

Target

  • Function

    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity

    Released primarily from activated T lymphocytes.
  • Involvement in disease

    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities

    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications

    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IF 1 antibody
    • IFG antibody
    • IFI antibody
    • IFN gamma antibody
    • IFN immune antibody
    • IFN, immune antibody
    • IFN-gamma antibody
    • IFNG antibody
    • IFNG_HUMAN antibody
    • Immune interferon antibody
    • Interferon gamma antibody
    • Type II Interferon antibody
    see all

Images

  • Immunohistochemical expression of IL-17, IL-23, IFN-γ and IL-22 in normal skin and BCC (basal cell carcinoma).

    Interferon gamma (IFN-γ) was detected using ab9657 in parafffin-embedded human normal skin and basal cell carcinoma skin tissue.

    (After Figure 1B of Pellegrini et al).

  • ab9657 staining Interferon gamma in human cervical squamous cell carcinoma section by Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections). Tissue underwent heat mediated antigen retrieval in sodium citrate buffer (pH 6.0). The primary antibody was used at 0.25 ug/ml and incubated with sample at 4°C overnight. A HRP-labeled polymer detection system was used with a DAB chromogen.

  • To detect Human IFN-γ by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.5 - 2.0 μg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with a compatible secondary detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant Human IFN-γ.

  • ab9657 staining Interferon gamma in human cervical squamous cell carcinoma section by Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections). Tissue underwent heat mediated antigen retrieval in sodium citrate buffer (pH 6.0). The primary antibody was used at 0.25 ug/ml and incubated with sample at 4°C overnight. A HRP-labeled polymer detection system was used with a DAB chromogen.

References

This product has been referenced in:

See all 41 Publications for this product

Customer reviews and Q&As

1-10 of 17 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (HT29 tumors taken out Balb/C nude mice)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Ph6
Permeabilization
No
Specification
HT29 tumors taken out Balb/C nude mice
Blocking step
Innovex background buster as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Nov 15 2019

Application
Western blot
Sample
Mouse Cell lysate - whole cell (CT26.WT (ATCC® CRL-2638™) cells)
Gel Running Conditions
Reduced Denaturing (4-20% Tris Glycin Gel, PVDF membrane)
Loading amount
20 µg
Specification
CT26.WT (ATCC® CRL-2638™) cells
Blocking step
Milk as blocking agent for 18 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jul 16 2019

Application
Western blot
Sample
Human Cell lysate - whole cell (HT-29 (ATCC® HTB-38™) cells)
Gel Running Conditions
Reduced Denaturing (4-20% Tris Glycin Gel, PVDF membrane)
Loading amount
20 µg
Specification
HT-29 (ATCC® HTB-38™) cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jul 16 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (B16 tumors)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH6
Permeabilization
No
Specification
B16 tumors
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jul 10 2019

Application
Immunocytochemistry
Sample
Human Cultured Cells (MDA-MB-231 (ATCC® HTB-26™) cells)
Permeabilization
Yes - 0.1% triton-X100 in PBS
Specification
MDA-MB-231 (ATCC® HTB-26™) cells
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jul 10 2019

Application
Immunocytochemistry
Sample
Mouse Cultured Cells (CT26.WT (ATCC® CRL-2638™) cells)
Permeabilization
Yes - 0.1% triton-X100 in PBS
Specification
CT26.WT (ATCC® CRL-2638™) cells
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jul 10 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Lymph node)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Both Tris-EDTA and Citrate-Sodium
Permeabilization
No
Specification
Lymph node
Blocking step
(agent) for 15 minute(s) · Concentration: 0.25% · Temperature: 22°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Feb 02 2016

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Human tumor lymph node (non-Hodgkin lymphoma, T ce)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate buffer, pH 6.0, 15 min
Permeabilization
No
Specification
Human tumor lymph node (non-Hodgkin lymphoma, T ce
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Oct 19 2015

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step
H2O2 as blocking agent for 10 minute(s) · Concentration: 3% · Temperature: 25°C
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: EDTA, pH9, 100C, 20min
Sample
Human Tissue sections (placenta)
Specification
placenta
Permeabilization
No
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Dec 17 2014

Application
Western blot
Sample
Mouse Serum (Mouse Serum 0.3 ul)
Gel Running Conditions
Reduced Non-Denaturing (Native) (12)
Loading amount
3 µg
Specification
Mouse Serum 0.3 ul
Blocking step
Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 26°C

Abcam user community

Verified customer

Submitted Jul 11 2014

1-10 of 17 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up