Overview

  • Product name

    Anti-Interferon gamma antibody (Biotin)
    See all Interferon gamma primary antibodies
  • Description

    Rabbit polyclonal to Interferon gamma (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Guinea pig
  • Immunogen

    Recombinant fragment corresponding to Guinea pig Interferon gamma aa 24-166.
    Sequence:

    QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIV SFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQI SVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK


    Database link: 100379568

  • Positive control

    • Recombinant Guinea Pig Interferon gamma protein

Properties

Applications

Our Abpromise guarantee covers the use of ab193426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity

    Released primarily from activated T lymphocytes.
  • Involvement in disease

    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities

    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications

    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Alternative names

    • IF 1 antibody
    • IFG antibody
    • IFI antibody
    • IFN gamma antibody
    • IFN immune antibody
    • IFN, immune antibody
    • IFN-gamma antibody
    • IFNG antibody
    • IFNG_HUMAN antibody
    • Immune interferon antibody
    • Interferon gamma antibody
    • Type II Interferon antibody
    see all

Images

  • Anti-Interferon gamma antibody (Biotin) (ab193426) at 2 µg/ml + Recombinant Guinea Pig Interferon gamma protein at 10 µg

    Secondary
    Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 20 kDa

References

ab193426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up