Anti-Interferon Receptor alpha antibody (ab244357)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Interferon Receptor alpha antibody -
Description
Rabbit polyclonal to Interferon Receptor alpha -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Interferon Receptor alpha aa 276-416.
Sequence:KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFD TEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWE NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Database link: P17181 -
Positive control
- IHC-P: Human kidney, placenta and tonsil tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244357 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Interferon Receptor alpha (IFN-a R1) is a class II cytokine receptor which belongs to type I human interferons (IFNs) family. IFNs plays a role in antiviral, antiproliferative, immunomodulatory, antitumor, and antiparasitic activities by inducing transcription of IFN-stimuated genes (ISGs) through activation of the Jak-STAT pathway. Specifically, Interferon Receptor alpha is a 135-kda signal transducing subunit of the IFN alpha/beta receptor complex (IFN-a R). Interferon Receptor alpha is phospholyated through PTK- and PKC-mediated phosphorylation, which initiates docking of STAT proteins to IFNs. This leads to activation of STAT proteins by PTK-mediated phosphorylation. The mechanism behind the amplification of Interferon Receptor alpha complex mediated transmembrane signaling has been linked to tyrosine phosphorylation on Interferon Receptor alpha. IFNAR1 possesses a large N-glycosylated ectodomain. -
Cellular localization
Membrane; single-pass type I membrane protein. -
Database links
- Entrez Gene: 3454 Human
- Omim: 107450 Human
- SwissProt: P17181 Human
- Unigene: 529400 Human
-
Alternative names
- AVP antibody
- IFN alpha R1 antibody
- IFN alpha REC antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Interferon Receptor alpha antibody (ab244357)PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling Interferon Receptor alpha using ab244357 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)Formalin-fixed, paraffin-embedded human placenta tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)Formalin-fixed, paraffin-embedded human kidney tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)Formalin-fixed, paraffin-embedded human tonsil tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis. No positivity in monocytes as expected.
Datasheets and documents
References
ab244357 has not yet been referenced specifically in any publications.
