Anti-Interferon Receptor alpha antibody (ab244357)
Key features and details
- Rabbit polyclonal to Interferon Receptor alpha
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Interferon Receptor alpha antibody -
Description
Rabbit polyclonal to Interferon Receptor alpha -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Interferon Receptor alpha aa 276-416.
Sequence:KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFD TEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWE NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Database link: P17181 -
Positive control
- IHC-P: Human kidney, placenta and tonsil tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244357 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Interferon Receptor alpha (IFN-a R1) is a class II cytokine receptor which belongs to type I human interferons (IFNs) family. IFNs plays a role in antiviral, antiproliferative, immunomodulatory, antitumor, and antiparasitic activities by inducing transcription of IFN-stimuated genes (ISGs) through activation of the Jak-STAT pathway. Specifically, Interferon Receptor alpha is a 135-kda signal transducing subunit of the IFN alpha/beta receptor complex (IFN-a R). Interferon Receptor alpha is phospholyated through PTK- and PKC-mediated phosphorylation, which initiates docking of STAT proteins to IFNs. This leads to activation of STAT proteins by PTK-mediated phosphorylation. The mechanism behind the amplification of Interferon Receptor alpha complex mediated transmembrane signaling has been linked to tyrosine phosphorylation on Interferon Receptor alpha. IFNAR1 possesses a large N-glycosylated ectodomain. -
Cellular localization
Membrane; single-pass type I membrane protein. -
Database links
- Entrez Gene: 3454 Human
- Omim: 107450 Human
- SwissProt: P17181 Human
- Unigene: 529400 Human
-
Alternative names
- AVP antibody
- IFN alpha R1 antibody
- IFN alpha REC antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling Interferon Receptor alpha using ab244357 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)
Formalin-fixed, paraffin-embedded human placenta tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)
Formalin-fixed, paraffin-embedded human kidney tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)
Formalin-fixed, paraffin-embedded human tonsil tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Interferon Receptor alpha antibody (ab244357)
Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for Interferon Receptor alpha with ab244357 at a 1/200 dilution in immunohistochemical analysis. No positivity in myocytes as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244357 has not yet been referenced specifically in any publications.