Overview

  • Product name
    Anti-Intersectin 1 antibody
    See all Intersectin 1 primary antibodies
  • Description
    Rabbit polyclonal to Intersectin 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Intersectin 1 aa 1-227. Expressed in E.coli.
    Sequence:

    MAQFPTPFGGSLDIWAITVEERAKHDQQFQSLKPISGFITGDQARNFFFQ SGLPQPVLAQIWALADMNKDGRMDQVEFSIAMKLIKLKLQGYQLPPALPP VMKQQPAAISSAPAFGIGGMAGMPPLTAVAPVPMGSIPVVGMSPPLVSSV PQAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQK AQSFDVASAPAAAEWAVPQSSRLKYRQ


    Database link: Q9WVE9

  • Positive control
    • WB: Recombinant rat Intersectin 1; Rat serum; Mouse gall bladder lysate. IHC-P: Rat cerebrum, kidney, heart, testis, liver and stomach tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 137 kDa.

Target

  • Function
    Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling. Inhibits ARHGAP31 activity toward RAC1.
  • Tissue specificity
    Isoform 2 is ubiquitous in adult and fetal tissues with high expression in skeletal muscle, heart, spleen, ovary, testis and all fetal tissues tested and low expression in thymus, blood, lung, liver and pancreas. Isoform 1 is expressed almost exclusively in the brain, in all brain regions. Not expressed in the spinal cord.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 2 EF-hand domains.
    Contains 2 EH domains.
    Contains 1 PH domain.
    Contains 5 SH3 domains.
  • Domain
    SH3-3, SH3-4 and SH3-5, but not SH3-1 and SH3-2 domains, bind to dynamin (By similarity). SH3-1 and SH3-4 bind to ARHGAP31.
    The KLERQ domain binds to SNAP-25 and SNAP-23.
  • Cellular localization
    Endomembrane system. Cell junction > synapse > synaptosome. Cell projection > lamellipodium.
  • Information by UniProt
  • Database links
  • Alternative names
    • Human intersectin SH3 domain containing protein SH3P17 antibody
    • Intersectin 1 SH3 domain protein antibody
    • intersectin 1 short form variant 3 antibody
    • intersectin 1 short form variant, 11 antibody
    • Intersectin short form antibody
    • intersectin short variant 12 antibody
    • Intersectin-1 antibody
    • Intersectin1 antibody
    • ITSN 1 antibody
    • ITSN antibody
    • itsn1 antibody
    • ITSN1_HUMAN antibody
    • MGC134948 antibody
    • MGC134949 antibody
    • OTTHUMP00000067855 antibody
    • OTTHUMP00000067856 antibody
    • OTTHUMP00000067857 antibody
    • OTTHUMP00000194810 antibody
    • OTTHUMP00000194811 antibody
    • OTTHUMP00000194812 antibody
    • OTTHUMP00000206688 antibody
    • SH3 domain containing protein 1A antibody
    • SH3 domain protein 1A antibody
    • SH3 domain-containing protein 1A antibody
    • SH3D1A antibody
    • SH3P17 antibody
    • Src homology 3 domain containing protein antibody
    see all

Images

  • Anti-Intersectin 1 antibody (ab231338) at 2 µg/ml + Recombinant rat Intersectin 1.

    Predicted band size: 137 kDa

  • Anti-Intersectin 1 antibody (ab231338) at 2 µg/ml + Mouse gallbladder lysate.

    Predicted band size: 137 kDa

  • Human IL-25 Multiplex Immunoassy Kit (ab231388) at 1 µg/ml + Rat serum.

    Predicted band size: 137 kDa

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Intersectin 1 using ab231338 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up