Overview

  • Product name

    Anti-Intestine specific homeobox antibody
    See all Intestine specific homeobox primary antibodies
  • Description

    Rabbit polyclonal to Intestine specific homeobox
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Intestine specific homeobox aa 1-245.
    Sequence:

    MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPE GPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKI FHFTHYPDVHIRSQLAARINLPEARVQIWFQNQRAKWRKQEKIGNLGAPQ QLSEASVALPTNLDVAGPTWTSTALRRLAPPTSCCPSAQDQLASAWFPAW ITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPKWGSICATST


    Database link: Q2M1V0

  • Positive control

    • IHC-P: Human endometrial cancer and glioma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcription factor that regulates gene expression in intestine. May participate in vitamin A metabolism most likely by regulating BCMO1 expression in the intestine.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781N2395 antibody
    • Intestine-specific homeobox antibody
    • Isx antibody
    • ISX_HUMAN antibody
    • MGC138417 antibody
    • OTTHUMP00000028558 antibody
    • Pancreas intestine homeodomain transcription factor antibody
    • Pix 1 antibody
    • RAX like homeobox antibody
    • RAX-like homeobox antibody
    • RAXLX antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer tissue stained for Intestine specific homeobox using ab238841 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for Intestine specific homeobox using ab238841 at 1/100 dilution in immunohistochemical analysis.

References

ab238841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up