Overview

  • Product name

    Anti-Intron-encoded endonuclease I-SceI antibody
  • Description

    Rabbit polyclonal to Intron-encoded endonuclease I-SceI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein corresponding to Saccharomyces cerevisiae Intron-encoded endonuclease I-SceI aa 1-235. The immunogen was tagged with a 6xHis tag and an S tag.
    Sequence:

    MKNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSR DEGKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWG AQTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWD YNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYI DSMSYLIFYNLIKPYLIPQMMYKLPNTISSETFLK


    Database link: P03882

  • Positive control

    • U2OS cells transfected with GFP-SCE1; 293T cells transfected with GFP-SCE1

Properties

Applications

Our Abpromise guarantee covers the use of ab216263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 18 kDa.
ICC/IF 1/600.

Images

  • All lanes : Anti-Intron-encoded endonuclease I-SceI antibody (ab216263) at 1/2000 dilution

    Lane 1 : Non-transfected 293T cells lysate
    Lane 2 : 293T cells transfected with GFP-SCE1 lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 18 kDa

  • Immunofluorescent analysis U2OS cells transfected with GFP-SCE1 (Green) labeling SCE1 using ab216263 at 1/600 dilution (red). DAPI staining is showed and the merge figure too

References

This product has been referenced in:

  • Tripathi V  et al. MRN complex-dependent recruitment of ubiquitylated BLM helicase to DSBs negatively regulates DNA repair pathways. Nat Commun 9:1016 (2018). Read more (PubMed: 29523790) »
  • Hu W  et al. Mitochondrial accumulation of amyloid beta (Aß) peptides requires TOMM22 as a main Aß receptor in yeast. J Biol Chem N/A:N/A (2018). WB . Read more (PubMed: 29925587) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up