Anti-INTS10 antibody (ab229619)
Key features and details
- Rabbit polyclonal to INTS10
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-INTS10 antibody
See all INTS10 primary antibodies -
Description
Rabbit polyclonal to INTS10 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Chicken, Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human INTS10 aa 451-710.
Sequence:FLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLA TCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDL KLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRG ENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLEL LPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCIN EKILLLQTLT
Database link: Q9NVR2 -
Positive control
- WB: Mouse kidney lysate; Rat gonadal lysate. IHC-P: Human kidney and small intestine tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab229619 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Predicted molecular weight: 82 kDa. |
Target
-
Relevance
INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit and mediates 3-prime end processing of small nuclear RNAs U1. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 422489 Chicken
- Entrez Gene: 101865575 Cynomolgus monkey
- Entrez Gene: 55174 Human
- Entrez Gene: 70885 Mouse
- Entrez Gene: 290679 Rat
- Omim: 611353 Human
- SwissProt: Q5ZLS8 Chicken
- SwissProt: Q4R7B1 Cynomolgus monkey
see all -
Alternative names
- C8orf35 antibody
- Chromosome 8 open reading frame 35 antibody
- FLJ10569 antibody
see all
Images
-
All lanes : Anti-INTS10 antibody (ab229619) at 1/1000 dilution
Lane 1 : Mouse kidney lysate
Lane 2 : Rat gonadal lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 82 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INTS10 antibody (ab229619)
Paraffin-embedded human kidney tissue stained for INTS10 using ab229619 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INTS10 antibody (ab229619)
Paraffin-embedded human small intestine tissue stained for INTS10 using ab229619 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab229619 has not yet been referenced specifically in any publications.