Overview

  • Product name

  • Description

    Rabbit polyclonal to INTS11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human INTS11 aa 502-594.
    Sequence:

    LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSV TVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG


    Database link: Q5TA45

  • Positive control

    • IHC-P: Human stomach tissue. WB: RT4 and U-251 MG sp cell lysates.
  • General notes

     This product was previously labelled as INT11

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 67 kDa.

Target

  • Function

    Catalytic component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Mediates the snRNAs 3' cleavage.
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS11 subfamily.
  • Domain

    The HXHXDH motif is essential for the endoribonuclease activity of the CPSF complex.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2410006F12Rik antibody
    • AU044035 antibody
    • Cleavage and polyadenylation specific factor 3 like antibody
    • Cleavage and polyadenylation-specific factor 3-like protein antibody
    • CPSF3 like protein antibody
    • CPSF3-like protein antibody
    • CPSF3L antibody
    • CPSF73L antibody
    • FLJ13294 antibody
    • FLJ20542 antibody
    • Human integrator complex subunit 11 antibody
    • INT 11 antibody
    • Int11 antibody
    • INT11_HUMAN antibody
    • Integrator complex subunit 11 antibody
    • INTS 11 antibody
    • INTS11 antibody
    • MGC124975 antibody
    • OTTHUMP00000044092 antibody
    • Protein related to CPSF subunits of 68 kDa antibody
    • RC 68 antibody
    • RC 68, related antibody
    • RC-68 antibody
    • RC68 antibody
    • Related to CPSF subunits 68 kDa antibody
    • Related to CPSF subunits, 68 kDa protein antibody
    • RGD1306841 antibody
    • RP23 242K15.19 antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for INTS11 using ab224757 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-INTS11 antibody (ab224757) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 67 kDa

References

ab224757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up