Overview

  • Product name

    Anti-INTS3 antibody
  • Description

    Rabbit polyclonal to INTS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human INTS3 aa 960-998 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRS


    Database link: Q68E01

  • Positive control

    • Mouse kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Function: Component of the Integrator complex. The Integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites. Similarity: Belongs to the Integrator subunit 3 family.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • C1orf193 antibody
    • C1orf60 antibody
    • FLJ21919 antibody
    • INT 3 antibody
    • Int3 antibody
    • INT3_HUMAN antibody
    • Integrator complex subunit 3 antibody
    • Ints3 antibody
    • Sensor of single-strand DNA complex subunit A antibody
    • Sensor of ssDNA subunit A antibody
    • SOSS complex subunit A antibody
    • SOSS-A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded mouse kidney tissue labeling INTS3 with ab214463 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up