Overview

  • Product name

  • Description

    Mouse polyclonal to INTS7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human INTS7 aa 1-962.
    Sequence:

    MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPR LFQKYPFPILINSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNV DEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAHHSIRQSLDSH DNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPI LQHMHHDAILASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTP KQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECAL QTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQE CCYHNNRGIAAHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQD DSPGAQATLKIALNCMVKLAKGRPHLSQSVVETLLTQLHSAQDAARILMC HCLAAIAMQLPVLGDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVA SQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLL TQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKG IASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIA TTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATL RNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMS VYNHVLEEVESLNRKYTPVSYMHTACLCNAIIALLKVPLSFQRYFFQKLQ STSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSKPGLFRKIQSV CLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILG THNITVESSVKDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPL QQQQQRNAYTRF


    Database link: NP_056249.1

  • Positive control

    • Transfected 293T cell line lysate; HeLa cells
  • General notes

     This product was previously labelled as DKFZP434B168, INTS7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 107 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Plays a role in DNA damage response (DDR) signaling during the S phase.
  • Sequence similarities

    Belongs to the Integrator subunit 7 family.
  • Cellular localization

    Nucleus. Chromosome. Localizes to sites of DNA damage in a H2AX-independent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • INTS7 antibody
    • 5930412E23Rik antibody
    • C1orf73 antibody
    • Chromosome 1 open reading frame 73 antibody
    • chunp6916 antibody
    • DKFZp434B168 antibody
    • FLJ10736 antibody
    • FLJ12447 antibody
    • Int7 antibody
    • INT7_HUMAN antibody
    • Integrator complex subunit 7 antibody
    • Ints7 antibody
    • Ints7 integrator complex subunit 7 antibody
    • OTTHUMP00000035211 antibody
    • RGD1308014 antibody
    see all

Images

  • All lanes : Anti-INTS7 antibody (ab167262) at 1 µg/ml

    Lane 1 : INTS7 transfected 293T cell line lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 107 kDa

  • Immunofluorescence analysis of HeLa cells, labeling INTS7 with ab167262 at 10 µg/ml.

References

ab167262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up