Overview

  • Product name

  • Description

    Rabbit polyclonal to INTS9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human INTS9 aa 368-658.
    Sequence:

    IQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSL NTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPL HVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIE IMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKK RKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIV LLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF


    Database link: Q9NV88

  • Positive control

    • WB: Jurkat, HeLa and MCF7 whole cell lysates. IHC-P: Human prostate cancer and ovarian cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as RC74

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Predicted molecular weight: 74, 71 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS9 subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CPSF antibody
    • CPSF2 antibody
    • CPSF2L antibody
    • FLJ10871 antibody
    • Int9 antibody
    • INT9_HUMAN antibody
    • Integrator complex subunit 9 antibody
    • INTS 9 antibody
    • INTS9 antibody
    • Protein related to CPSF subunits of 74 kDa antibody
    • RC 74 antibody
    • RC-74 antibody
    • RC74 antibody
    • Related to CPSF subunits 74 kDa antibody
    see all

Images

  • All lanes : Anti-INTS9 antibody (ab234700) at 1/2000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 74, 71 kDa

  • Paraffin-embedded human prostate cancer tissue stained for INTS9 using ab234700 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for INTS9 using ab234700 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for INTS9 (green) using ab234700 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up