Overview

  • Product name

  • Description

    Rabbit polyclonal to INTU
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human INTU aa 278-368.
    Sequence:

    KTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEI LYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLL

  • Positive control

    • Human cerebellum tissue
  • General notes

     This product was previously labelled as PDZD6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab122354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the inturned family.
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homolog of inturned (X. tropicalis) antibody
    • INT antibody
    • intu antibody
    • Inturned planar cell polarity effector homolog antibody
    • KIAA1284 antibody
    • PDZ domain containing 6 antibody
    • PDZ domain-containing protein 6 antibody
    • PDZD 6 antibody
    • PDZD6_HUMAN antibody
    • PDZK6 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleoli and vesicles. Recommended concentration of ab122354 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122354, at 1/15 dilution, staining INTU in paraffin-embedded Human cerebellum tissue by Immunohistochemistry.

References

ab122354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up