Overview

  • Product name

    Anti-Invertase antibody (HRP)
    See all Invertase primary antibodies
  • Description

    Goat polyclonal to Invertase (HRP)
  • Host species

    Goat
  • Conjugation

    HRP
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Immunogen

    Full length native protein (purified) corresponding to Invertase. Candida species.
    Sequence:

    MIQLSPLLLLPLFSVFNSIADASTEYLRPQIHLTPDQGWMNDPNGMFYDR KDKLWHVYFQHNPDKKSIWATPVTWGHSTSKDLLTWDYHGNALEPENDDE GIFSGSVVVDRNNTSGFFNDSTDPEQRIVAIYTNNAQLQTQEIAYSLDKG YSFIKYDQNPVINVNSSQQRDPKVLWHDESNQWIMVVAKTQEFKVQIYGS PDLKKWDLKSNFTSNGYLGFQYECPGLFKLPIENPLNDTVTSKWVLLLAI NPGSPLGGSINEYFIGDFDGTTFHPDDGATRFMDIGKDFYAFQSFDNTEP EDGALGLAWASNWQYANTVPTE NWRSSMSLVRNYTLKYVDVNPENYGL TLIQKPVYDTKETRLNETLKTLETINEYEVNDLKLDKSSFVATDFNTERN ATGVFEFDLKFTQTDLKMGYSNMTTQFGLYIHSQTVKGSQETLQLVFDTL STTWYIDRTTQHSFQRNSPVFTERISTYVEKIDTTDQGNVYTLYGVVDRN ILELYFNDGSIAMTNTFFFREGKIPTSFEVVCDSEKSFITIDELSVRELA RK


    Database link: P40912

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at +4°C. Do Not Freeze.
  • Storage buffer

    pH: 7.2
    Preservative: 0.01% Gentamicin sulphate
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA

    Do not add Sodium Azide. BSA Immunoglobulin and Protease free.
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    ab181624 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against buffer. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Peroxidase, anti-Goat Serum as well as purified and partially purified Invertase.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000 - 1/40000.

ab181624 has been assayed against 1.0 µg of Invertase in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at room temperature.

WB 1/1000 - 1/5000. Predicted molecular weight: 63 kDa.

Target

  • Relevance

    Invertase hydrolyses the terminal non reducing beta D fructofuranoside residues in beta D fructofuranosides. It is the enzyme that bees use to convert nectar into honey. Industrial and confectionary applications use yeast invertase to split sucrose into fructose and glucose and also to improve the shelf life of food products.
  • Alternative names

    • Beta fructofuranosidase 2 antibody
    • Inv1 antibody
    • Saccharase antibody
    • Sucrase antibody

References

ab181624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up