Overview

  • Product name

    Anti-Involucrin antibody [IVRN/2113R]
    See all Involucrin primary antibodies
  • Description

    Rabbit monoclonal [IVRN/2113R] to Involucrin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Does not react with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Involucrin aa 1-585.
    Sequence:

    MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVE LPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQK AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE QLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQE GQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQE GQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQE KQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQE GQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQE GQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQL EVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQP KHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPG QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK


    Database link: P07476

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from bioreactor concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    IVRN/2113R
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.1 - 0.2 µg/ml.

Staining of formalin-fixed tissues is enhanced by digestion with trypsin or Protease XXV at 1 mg/ml PBS for 5 minutes at 37°C. (Note than enzyme digestion is better than citrate buffer based epitope unmasking). Incubate with primary antibody for 30 minutes at room temperature.

Target

  • Function

    Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
  • Tissue specificity

    Keratinocytes of epidermis and other stratified squamous epithelia.
  • Sequence similarities

    Belongs to the involucrin family.
  • Post-translational
    modifications

    Substrate of transglutaminase. Some glutamines and lysines are cross-linked to other involucrin molecules, to other proteins such as keratin, desmoplakin, periplakin and envoplakin, and to lipids like omega-hydroxyceramide.
  • Cellular localization

    Cytoplasm. Constituent of the scaffolding of the cornified envelope.
  • Information by UniProt
  • Database links

  • Alternative names

    • INVO_HUMAN antibody
    • Involucrin antibody
    • IVL antibody

Images

  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for Involucrin with ab234403 at 0.2 µg/ml in immunohistochemical analysis.

References

ab234403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up