Overview

  • Product name

  • Description

    Rabbit polyclonal to IP6K1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human IP6K1 aa 84-152.
    Sequence:

    DSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKE EKASLSLETSESSQEAKSP


    Database link: Q92551

  • Positive control

    • WB: PC-3 cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 50 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for IP6K1 (green) using ab243706 at 4 µg/ml in ICC/IF.

  • Anti-IP6K1 antibody (ab243706) at 0.4 µg/ml + PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Predicted band size: 50 kDa

References

ab243706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up