Overview

  • Product name

  • Description

    Rabbit polyclonal to IPO11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human IPO11 aa 823-916.
    Sequence:

    QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIIN ISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD


    Database link: Q9UI26

  • Positive control

    • Human cerebral cortex tissue; RT-4 and U-251 MG cell lysates; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 113 kDa.
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of UBE2E3, and of RPL12.
  • Sequence similarities

    Belongs to the importin beta family.
    Contains 15 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Imp11 antibody
    • Importin 11 antibody
    • Importin-11 antibody
    • IPO11 antibody
    • IPO11_HUMAN antibody
    • Ran binding protein 11 antibody
    • Ran-binding protein 11 antibody
    • RanBP11 antibody
    • SLRN antibody
    • Synleurin antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling IPO11 with ab221615 at 1/2500 dilution.

  • All lanes : Anti-IPO11 antibody (ab221615) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 113 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling IPO11 with ab221615 at 4 μg/ml (green).

References

ab221615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up