Overview

  • Product name

  • Description

    Rabbit polyclonal to IPT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IPT aa 1-324.
    Sequence:

    MGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQV FEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQADERLDKR VDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLI TEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPP VYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRS YHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVS PDHNKEPKEKGSPGQNDQELKCSV


    Database link: Q9H3H1-3

  • Positive control

    • WB: Jurkat and Raji whole cell lysates. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 37, 53 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
  • Sequence similarities

    Belongs to the IPP transferase family.
    Contains 1 matrin-type zinc finger.
  • Cellular localization

    Cytoplasm and Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310075G14Rik antibody
    • AI314189 antibody
    • AI314635 antibody
    • AV099619 antibody
    • FLJ20061 antibody
    • hGRO1 antibody
    • IPP transferase antibody
    • IPPT antibody
    • IPT antibody
    • IPTase antibody
    • Isopentenyl diphosphate:tRNA isopentenyltransferase antibody
    • Isopentenyl-diphosphate:tRNA isopentenyltransferase antibody
    • MGC149242 antibody
    • MGC149243 antibody
    • mitochondrial antibody
    • MOD5 antibody
    • MOD5_HUMAN antibody
    • OTTMUSP00000009314 antibody
    • Putative protein TR2IT1 antibody
    • RP23-121J14.6 antibody
    • TRIT 1 antibody
    • TRIT1 antibody
    • tRNA dimethylallyltransferase antibody
    • tRNA isopentenylpyrophosphate transferase antibody
    • tRNA isopentenyltransferase 1 antibody
    • tRNA isopentenyltransferase antibody
    • tRNA isopentenyltransferase mitochondrial antibody
    see all

Images

  • All lanes : Anti-IPT antibody (ab235372) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 37, 53 kDa

  • Paraffin-embedded human liver tissue stained for IPT using ab235372 at 1/100 dilution in immunohistochemical analysis.

References

ab235372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up