Overview

  • Product name

    Anti-IQCK antibody
  • Description

    Rabbit polyclonal to IQCK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IQCK aa 158-264.
    Sequence:

    ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPI PLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQV KIFWAKQ


    Database link: Q8N0W5

  • Positive control

    • WB: HEK-293T overexpressing IQCK cell lysate. IHC-P: Human fallopian tube tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.

Target

  • Relevance

    The specific function of this protein remains unknown.
  • Database links

  • Alternative names

    • FLJ20115 antibody
    • FLJ36575 antibody
    • IQ domain containing protein K antibody
    • MGC35048 antibody

Images

  • All lanes : Anti-IQCK antibody (ab224472) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with vector only, cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with IQCK with C-terminal myc-DDK tag (~3.1 kDa), cell lysate

    Developed using the ECL technique.

    Predicted band size: 33 kDa

  • Paraffin-embedded human fallopian tube tissue stained for IQCK with ab224472 at 1/20 dilution in immunohistochemical analysis.

References

ab224472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up