Anti-IQGAP3 antibody (ab219354)
Key features and details
- Rabbit polyclonal to IQGAP3
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IQGAP3 antibody
See all IQGAP3 primary antibodies -
Description
Rabbit polyclonal to IQGAP3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human IQGAP3 aa 1165-1325. (BC131536).
Sequence:SEVYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGGALAAPQRHALGAVAQ LLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPEERFA VDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLED LGELPTIPDLI
Database link: Q86VI3 -
Positive control
- IHC-P; Human kidney tissue. WB; Human fetal lung lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab219354 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 µg/ml. | |
WB | 1/500 - 1/1000. Predicted molecular weight: 185 kDa. |
Target
-
Sequence similarities
Contains 1 CH (calponin-homology) domain.
Contains 4 IQ domains.
Contains 1 Ras-GAP domain. - Information by UniProt
-
Database links
- Entrez Gene: 128239 Human
- SwissProt: Q86VI3 Human
- Unigene: 591495 Human
-
Alternative names
- IQ motif containing GTPase activating protein 3 antibody
- IQGA3_HUMAN antibody
- IQGAP 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IQGAP3 antibody (ab219354)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling IQGAP3 with ab219354 at 5 µg/ml.
-
Anti-IQGAP3 antibody (ab219354) at 1/500 dilution + Human fetal lung lysate
Predicted band size: 185 kDa
Protocols
Datasheets and documents
References (1)
ab219354 has been referenced in 1 publication.
- Dongol S et al. IQGAP3 promotes cancer proliferation and metastasis in high-grade serous ovarian cancer. Oncol Lett 20:1179-1192 (2020). PubMed: 32724358