Overview

  • Product name

    Anti-IRAK4 (phospho T345) antibody
    See all IRAK4 primary antibodies
  • Description

    Rabbit polyclonal to IRAK4 (phospho T345)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide aa 330-360 (phospho T345) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    FGLARASEKFAQTVMTSRIVGTTAYMAPEAL


    Database link: Q9NWZ3

  • Positive control

    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/500.

Target

  • Function

    Required for the efficient recruitment of IRAK1 to the IL-1 receptor complex following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. Phosphorylates IRAK1.
  • Involvement in disease

    Defects in IRAK4 are the cause of recurrent isolated invasive pneumococcal disease type 1 (IPD1) [MIM:610799]. Recurrent invasive pneumococcal disease (IPD) is defined as two episodes of IPD occurring at least 1 month apart, whether caused by the same or different serotypes or strains. Recurrent IPD occurs in at least 2% of patients in most series, making IPD the most important known risk factor for subsequent IPD.
    Defects in IRAK4 are the cause of IRAK4 deficiency (IRAK4D) [MIM:607676]. IRAK4 deficiency causes extracellular pyogenic bacterial and fungal infections in otherwise healthy children.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.
    Contains 1 death domain.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL-1 receptor-associated kinase 4 antibody
    • Interleukin 1 receptor associated kinase 4 mutant form 1 antibody
    • Interleukin-1 receptor-associated kinase 4 antibody
    • Interleukin1 receptor associated kinase 4 antibody
    • IPD1 antibody
    • IRAK 4 antibody
    • IRAK-4 antibody
    • IRAK4 antibody
    • IRAK4 mutated form 1 antibody
    • IRAK4_HUMAN antibody
    • LOC 51135 antibody
    • NY REN 64 antibody
    • NY REN 64 antigen antibody
    • NY-REN-64 antibody
    • REN64 antibody
    • Renal carcinoma antigen NY-REN-64 antibody
    see all

Images

  • Anti-IRAK4 (phospho T345) antibody (ab216513) at 1/500 dilution + NIH/3T3 lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma labeling IRAK4 (phospho T345) with ab216513 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up