Overview

  • Product name

  • Description

    Rabbit polyclonal to IREB2/IRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human IREB2/IRP2 aa 39-281. Expressed in E.coli.
    Sequence:

    PYSIRVLLEAAVRNCDGFLMKKEDVMNILDWKTKQSNVEVPFFPARVLLQ DFTGIPAMVDFAAMREAVKTLGGDPEKVHPACPTDLTVDHSLQIDFSKCA IQNAPNPGGGDLQKAGKLSPVKVQPKKLPCRGQTTCRGSCDSGELGRNSG TFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRV FKNVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTDS


    Database link: P48200

  • Positive control

    • WB: Recombinant human IREB2/IRP2 protein; Pig liver lysate; Human lung tissue lysate; HeLa and A549 whole cell lysates. IHC-P: Human kidney, skin cancer and lung cancer tissue.
  • General notes

     This product was previously labelled as IREB2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 105 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    RNA-binding protein that binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. Binding to the IRE element in ferritin results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.
  • Sequence similarities

    Belongs to the aconitase/IPM isomerase family.
  • Post-translational
    modifications

    Ubiquitinated and degraded by the proteasome in presence of high level of iron and oxygen. Ubiquitinated by a SCF complex containing FBXL5. Upon iron and oxygen depletion FBXL5 is degraded, preventing ubiquitination and allowing its RNA-binding activity.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACO3 antibody
    • FLJ23381 antibody
    • IRE BP2 antibody
    • IRE-BP 2 antibody
    • IREB 2 antibody
    • IREB2 antibody
    • IREB2_HUMAN antibody
    • Iron regulatory protein 2 antibody
    • iron responsive element binding protein 2 antibody
    • Iron-responsive element-binding protein 2 antibody
    • IRP 2 antibody
    • IRP2 antibody
    • IRP2AD antibody
    • OTTHUMP00000185022 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for IREB2/IRP2 using ab232994 at 10μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for IREB2/IRP2 using ab232994 at 10μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for IREB2/IRP2 using ab232994 at 10μg/ml in immunohistochemical analysis.

  • Anti-IREB2/IRP2 antibody (ab232994) at 3 µg/ml + Recombinant human IREB2/IRP2

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 105 kDa

  • All lanes : Anti-IREB2/IRP2 antibody (ab232994) at 3 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Human lung tissue lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 105 kDa

References

ab232994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up