Overview

  • Product name

    Anti-IRF2BP1 antibody [OTI3A6]
    See all IRF2BP1 primary antibodies
  • Description

    Mouse monoclonal [OTI3A6] to IRF2BP1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human IRF2BP1 aa 457-584. Produced in E.coli (NP_056464).
    Sequence:

    SSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLC RERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVG SSVPWAFMQGEIATILAGDIKVKKERDP


    Database link: Q8IU81

  • Positive control

    • WB: HEK-293T cell lysates transfected with pCMV6-ENTRY IRF2BP1 cDNA for 48 hrs. IHC-P: Human breast, breast adenocarcinoma, kidney, liver, thyroid, prostate and prostate carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI3A6
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500.

Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 8.5 before commencing with IHC staining protocol.

WB 1/2000. Predicted molecular weight: 62 kDa.

Target

  • Function

    Acts as a transcriptional repressor. Acts as a transcriptional corepressor in a IRF2-dependent manner. This repression is not mediated at least in part by histone deacetylase activities.
  • Sequence similarities

    Belongs to the IRF2BP family.
  • Domain

    The C-terminal RING-type zinc finger domain is necessary for interaction with BAP1.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434M154 antibody
    • I2BP1_HUMAN antibody
    • Interferon regulatory factor 2 binding protein 1 antibody
    • Interferon regulatory factor 2-binding protein 1 antibody
    • IRF 2BP1 antibody
    • IRF-2-binding protein 1 antibody
    • IRF-2BP1 antibody
    • IRF2 binding protein 1 antibody
    • Irf2bp1 antibody
    see all

Images

  • All lanes : Anti-IRF2BP1 antibody [OTI3A6] (ab236392) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysates transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysates transfected with pCMV6-ENTRY IRF2BP1 cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 62 kDa

  • Paraffin-embedded human breast tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast adenocarcinoma tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for IRF2BP1 using ab236392 at 1/500 dilution in immunohistochemical analysis.

References

ab236392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up