Overview

  • Product name

  • Description

    Rabbit polyclonal to IRF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human IRF3 aa 60-95 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAED


    Database link: Q14653

  • Positive control

    • Mouse stomach tissue; Human kidney and colon carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab218160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Mediates interferon-stimulated response element (ISRE) promoter activation. Functions as a molecular switch for antiviral activity. DsRNA generated during the course of an viral infection leads to IRF3 phosphorylation on the C-terminal serine/threonine cluster. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of genes under the control of ISRE. The complex binds to the IE and PRDIII regions on the IFN-alpha and IFN-beta promoters respectively. IRF-3 does not have any transcription activation domains.
  • Tissue specificity

    Expressed constitutively in a variety of tissues.
  • Sequence similarities

    Belongs to the IRF family.
    Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
  • Post-translational
    modifications

    Constitutively phosphorylated on many serines residues. C-terminal serine/threonine cluster is phosphorylated in response of induction by IKBKE and TBK1. Ser-385 and Ser-386 may be specifically phosphorylated in response to induction. An alternate model propose that the five serine/threonine residues between 396 and 405 are phosphorylated in response to a viral infection. Phosphorylation, and subsequent activation of IRF3 is inhibited by vaccinia virus protein E3.
    Ubiquitinated; ubiquitination involves RBCK1 leading to proteasomal degradation. Polyubiquitinated; ubiquitination involves TRIM21 leading to proteasomal degradation.
    ISGylated by HERC5 resulting in sustained IRF3 activation and in the inhibition of IRF3 ubiquitination by disrupting PIN1 binding. The phosphorylation state of IRF3 does not alter ISGylation.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between cytoplasmic and nuclear compartments, with export being the prevailing effect. When activated, IRF3 interaction with CREBBP prevents its export to the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • IIAE7 antibody
    • Interferon regulatory factor 3 antibody
    • IRF 3 antibody
    • IRF-3 antibody
    • IRF3 antibody
    • IRF3_HUMAN antibody
    • MGC94729 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse stomach tissue labeling IRF3 with ab218160 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling IRF3 with ab218160 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling IRF3 with ab218160 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up