Overview

  • Product name
  • Description
    Rabbit polyclonal to IRF5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human IRF5 aa 1-498.
    Sequence:

    MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHA TRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDF RLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL APPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDL EIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFG EEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ


    Database link: Q13568

  • Positive control
    • Jurkat and A549 cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab175317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 56 kDa.

Target

  • Involvement in disease
    Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) [MIM:612245]. IBD14 is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
    Genetic variations in IRF5 are associated with susceptibility to systemic lupus erythematosus type 10 (SLEB10) [MIM:612251]. Systemic lupus erythematosus (SLE) is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
    Genetic variations in IRF5 are a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures.
  • Sequence similarities
    Belongs to the IRF family.
    Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Interferon regulatory factor 5 antibody
    • Interferon regulatory factor 5 bone marrow variant antibody
    • IRF 5 antibody
    • IRF-5 antibody
    • Irf5 antibody
    • IRF5_HUMAN antibody
    • SLEB10 antibody
    see all

Images

  • All lanes : Anti-IRF5 antibody (ab175317) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : A549 cell lysate

    Predicted band size: 56 kDa

References

This product has been referenced in:
  • Byrne AJ  et al. A critical role for IRF5 in regulating allergic airway inflammation. Mucosal Immunol 10:716-726 (2017). Read more (PubMed: 27759022) »
  • Inoue M  et al. T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. Proc Natl Acad Sci U S A 111:5295-300 (2014). WB, ICC/IF ; Mouse . Read more (PubMed: 24706909) »
See all 2 Publications for this product

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Macrophages)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Ventana Ultra CC1
Permeabilization
No
Specification
Macrophages
Blocking step
Hydrogen Peroxide as blocking agent for 4 minute(s) · Concentration: 3.0% · Temperature: 36°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jan 25 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up