Overview

  • Product name

  • Description

    Rabbit polyclonal to IRG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IRG1 aa 57-257.
    Sequence:

    SKIYSSNISSTVWGQPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSG AVLPVLTALAEALPRSPKFSGLDLLLAFNVGIEVQGRLLHFAKEANDMPK RFHPPSVVGTLGSAAAASKFLGLSSTKCREALAIAVSHAGAPMANAATQT KPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKVLPS I


    Database link: A6NK06

  • Positive control

    • IHC-P: Human glioma and appendix tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the prpD family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACOD1 antibody
    • Aconitate decarboxylase 1 antibody
    • Aconitate decarboxylase antibody
    • CAD antibody
    • Cis aconitate decarboxylase antibody
    • Immune responsive gene 1 protein homolog antibody
    • Immune-responsive gene 1 protein homolog antibody
    • Immunoresponsive 1 homolog (mouse) antibody
    • Irg1 antibody
    • IRG1_HUMAN antibody
    • OC116 antibody
    • OPTB1 antibody
    • TCTIRC7 antibody
    see all

Images

  • Paraffin-embedded human glioma tissue stained for IRG1 using ab238580 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human appendix tissue stained for IRG1 using ab238580 at 1/100 dilution in immunohistochemical analysis.

References

ab238580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up