Overview

  • Product name

  • Description

    Rabbit polyclonal to IRS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human IRS2 aa 540-590 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    YGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQ P


    Database link: Q9Y4H2

  • Positive control

    • Human colon carcinoma and rat skeletal muscle tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat skeletal muscle tissue labeling IRS2 with ab203051 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling IRS2 with ab203051 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up