Overview

  • Product name

    Anti-IRX7 antibody
  • Description

    Rabbit polyclonal to IRX7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human IRX7 aa 289-389.
    Sequence:

    AQSLPGPCAAAREGRLERRECGLAAPRFSFNDPSGSEEADFLSAETGSPR LTMHYPCLEKPRIWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPAS A


    Database link: P78412

  • Positive control

    • WB: A549 whole cell lysate; Rat heart lysate. IHC-P: Human cervical cancer tissue.
  • General notes

     This product was previously labelled as IRX6

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 48 kDa.

Target

  • Sequence similarities

    Belongs to the TALE/IRO homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeodomain protein IRXB3 antibody
    • Iroquois class Homeodomain Protein 6 antibody
    • Iroquois class homeodomain protein IRX 6 antibody
    • Iroquois class homeodomain protein IRX6 antibody
    • Iroquois homeobox 6 antibody
    • Iroquois homeobox protein 1 like antibody
    • Iroquois homeobox protein 6 antibody
    • Iroquois homeobox protein 7 antibody
    • Iroquois-class homeodomain protein IRX-6 antibody
    • IRX 3 antibody
    • IRX 6 antibody
    • IRX3 antibody
    • Irx6 antibody
    • IRX6_HUMAN antibody
    • IRX7 antibody
    • IRXB3 antibody
    see all

Images

  • All lanes : Anti-IRX7 antibody (ab234984) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : Rat heart lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human cervical cancer tissue stained for IRX7 using ab234984 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab234984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up