Overview

  • Product name

    Anti-ISCA2 antibody
  • Description

    Rabbit polyclonal to ISCA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ISCA2 aa 9-154. Full length protein without the transit protein (1-8 aa).
    Sequence:

    LTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQ RLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVV DSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL


    Database link: Q86U28

  • Positive control

    • WB: HL-60 whole cell lysate. IHC-P: Human prostate cancer and tonsil tissue.
  • General notes

     This product was previously labelled as HBLD1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.
  • Sequence similarities

    Belongs to the hesB/iscA family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • c14_5557 antibody
    • HESB like domain containing 1 antibody
    • HESB like domain containing protein 1 antibody
    • HESB-like domain-containing protein 1 antibody
    • iron sulfur cluster assembly 2 homolog (S. cerevisiae) antibody
    • Iron sulfur cluster assembly 2 homolog, mitochondrial antibody
    • Iron-sulfur cluster assembly 2 homolog, mitochondrial antibody
    • ISCA2 antibody
    • ISCA2_HUMAN antibody
    see all

Images

  • Anti-ISCA2 antibody (ab235776) at 1/1000 dilution + HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human tonsil tissue stained for ISCA2 using ab235776 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for ISCA2 using ab235776 at 1/100 dilution in immunohistochemical analysis.

References

ab235776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up