Overview

  • Product name

  • Description

    Rabbit polyclonal to ISG15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ISG15 aa 2-157. Two N-terminal tags. (expressed in E.coli).
    Sequence:

    GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSG VALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLT QTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMN LRLRGG


    Database link: P05161

  • Positive control

    • WB: Recombinant human ISG15 protein; Pig kidney and cerebrum tissue lysate. IHC-P: Human cerebrum, colorectal cancer and glioma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 18 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections.
    In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.
  • Tissue specificity

    Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons.
  • Sequence similarities

    Contains 2 ubiquitin-like domains.
  • Cellular localization

    Cytoplasm. Secreted. UCRP conjugates seem to be noncovalently associated with the intermediate filaments and distributed in a punctate pattern. Also secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • G1P2 antibody
    • hUCRP antibody
    • IFI 15 antibody
    • IFI15 antibody
    • Interferon alpha inducible protein antibody
    • Interferon induced protein 15 antibody
    • Interferon induced protein IFI-15K antibody
    • Interferon stimulated protein 15 kDa antibody
    • Interferon, alpha-inducible protein (clone IFI-15K) antibody
    • Interferon-induced 15 kDa protein antibody
    • Interferon-induced 17 kDa protein antibody
    • Interferon-induced 17-kDa/15-kDa protein antibody
    • IP17 antibody
    • ISG 15 antibody
    • ISG15 antibody
    • ISG15 ubiquitin like modifier antibody
    • ISG15_HUMAN antibody
    • Ubiquitin cross-reactive protein antibody
    • Ubiquitin-like protein ISG15 antibody
    • UCRP antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for ISG15 using ab233071 at 30μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for ISG15 using ab233071 at 30μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for ISG15 using ab233071 at 30μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ISG15 antibody (ab233071) at 2 µg/ml + Recombinant human ISG1 protein.

    Developed using the ECL technique.

    Predicted band size: 18 kDa

  • Anti-ISG15 antibody (ab233071) at 2 µg/ml + Pig kidney tissue lysate

    Developed using the ECL technique.

    Predicted band size: 18 kDa

  • Anti-ISG15 antibody (ab233071) at 2 µg/ml + Pig cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 18 kDa

References

ab233071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up