Overview

  • Product name

  • Description

    Rabbit polyclonal to ISLR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ISLR aa 19-428. Full length mature chain, expressed in E. coli.
    Sequence:

    CPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEG AFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDL HNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTP LTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKG TPLSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLH WHIQIPSGIVEITSPNVGTDGRALPGTPVASSQPRFQAFANGSLLIPDFG KLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKG CYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQS LLLFFFLTSF


    Database link: O14498

  • Positive control

    • WB: Recombinant human ISLR protein. Human serum. IHC-P: Human stomach, prostate and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab232986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 46 kDa.

Target

  • Tissue specificity

    Expressed in various tissues including retina, heart, skeletal muscle, prostate, ovary, small intestine, thyroid, adrenal cortex, testis, stomach and spinal cord.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 5 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Developmental stage

    Expressed in fetal lung and kidney.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW553146 antibody
    • HsT17563 antibody
    • Immunoglobulin superfamily containing leucine-rich repeat protein antibody
    • Islr antibody
    • ISLR_HUMAN antibody
    • MGC102816 antibody
    • OTTHUMP00000174967 antibody
    • OTTHUMP00000174968 antibody
    • UNQ189/PRO215 antibody
    see all

Images

  • Anti-ISLR antibody (ab232986) at 2 µg/ml + Human serum

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 46 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for ISLR with ab232986 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for ISLR with ab232986 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for ISLR with ab232986 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-ISLR antibody (ab232986) at 2 µg/ml + Recombinant human ISLR protein

    Secondary
    HRP-Linked Guinea pig
    Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 46 kDa

References

ab232986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up