Overview

  • Product name

  • Description

    Rabbit polyclonal to ITGA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ITGA7 aa 730-780 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKP L


    Database link: Q13683

  • Positive control

    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/50 - 1/500.
WB 1/100 - 1/1000. Predicted molecular weight: 129 kDa.

Target

  • Function

    Integrin alpha-7/beta-1 is the primary laminin receptor on skeletal myoblasts and adult myofibers. During myogenic differentiation, it may induce changes in the shape and mobility of myoblasts, and facilitate their localization at laminin-rich sites of secondary fiber formation. It is involved in the maintenance of the myofibers cytoarchitecture as well as for their anchorage, viability and functional integrity. Isoform Alpha-7X2B and isoform Alpha-7X1B promote myoblast migration on laminin 1 and laminin 2/4, but isoform Alpha-7X1B is less active on laminin 1 (In vitro). Acts as Schwann cell receptor for laminin-2. Acts as a receptor of COMP and mediates its effect on vascular smooth muscle cells (VSMCs) maturation (By similarity). Required to promote contractile phenotype acquisition in differentiated airway smooth muscle (ASM) cells.
  • Tissue specificity

    Isoforms containing segment A are predominantly expressed in skeletal muscle. Isoforms containing segment B are abundantly expressed in skeletal muscle, moderately in cardiac muscle, small intestine, colon, ovary and prostate and weakly in lung and testes. Isoforms containing segment X2D are expressed at low levels in fetal and adult skeletal muscle and in cardiac muscle, but are not detected in myoblasts and myotubes. In muscle fibers isoforms containing segment A and B are expressed at myotendinous and neuromuscular junctions; isoforms containing segment C are expressed at neuromuscular junctions and at extrasynaptic sites. Isoforms containing segments X1 or X2 or, at low levels, X1X2 are expressed in fetal and adult skeletal muscle (myoblasts and myotubes) and cardiac muscle.
  • Involvement in disease

    Defects in ITGA7 are the cause of muscular dystrophy congenital due to integrin alpha-7 deficiency (MDCI) [MIM:613204]. A form of congenital muscular dystrophy. Patients present at birth, or within the first few months of life, with hypotonia, muscle weakness and often with joint contractures.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
  • Developmental stage

    In renewing intestinal epithelium, expression of isoforms containing segment B correlates with the onset of enterocytic differentiation.
  • Post-translational
    modifications

    ADP-ribosylated on at least two sites of the extracellular domain in skeletal myotubes.
    A 70 kDa form is created by proteolytic cleavage. Cleavage is elevated during myogenic differentiation and the cleaved form enhances cell adhesion and spreading on laminin.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha 7 antibody
    • FLJ25220 antibody
    • Integrin alpha 7 antibody
    • Integrin alpha 7 chain antibody
    • Integrin alpha 7 heavy chain antibody
    • Integrin alpha 7 light chain antibody
    • Integrin alpha-7 70 kDa form antibody
    • ITA7_HUMAN antibody
    • ITGA 7 antibody
    • Itga7 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue sections labeling ITGA7 with ab203254 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue sections labeling ITGA7 with ab203254 at a 1/200 dilution, followed by conjugation to the secondary antibody (Goat Anti-Rabbit IgG, Cy3 conjugated) used at 1/200 dilution for 40 minutes at 37°C. 

References

This product has been referenced in:

  • Nakao M  et al. Formation of Large Scaffold-Free 3-D Aggregates in a Cell Culture Dish by Ultrasound Standing Wave Trapping. Ultrasound Med Biol 45:1306-1315 (2019). Read more (PubMed: 30799124) »
  • Bhandari A  et al. ITGA7 functions as a tumor suppressor and regulates migration and invasion in breast cancer. Cancer Manag Res 10:969-976 (2018). Read more (PubMed: 29760566) »
See all 3 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (olfactory ensheathing cells (neural crest cells) i)
Permeabilization
No
Specification
olfactory ensheathing cells (neural crest cells) i
Blocking step
Serum as blocking agent for 1 hour(s) and 15 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Paraformaldehyde

Dr. Rana Khankan

Verified customer

Submitted May 12 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up