Overview

  • Product name

  • Description

    Rabbit polyclonal to ITGB3BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ITGB3BP aa 1-177.
    Sequence:

    MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSS EEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEI MEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQK LFEKSTGLPHKASRHLDSYEFLKAILN


    Database link: Q13352

Properties

Applications

Our Abpromise guarantee covers the use of ab192324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 20 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Relevance

    ITGB3BP is a transcriptional coregulator that has both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP also acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit. ITGB3BP induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization. It also acts as a component of the CENPH-CENPI centromeric complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation.
  • Cellular localization

    Isoform 1: Nucleus. Isoform 2: Nucleus. Isoform 3: Nucleus. Cytoplasm. Isoform 4: Cytoplasm. Note=Localizes in the centromeres. Isoform 3 is predominantly nuclear and weakly cytoplasmic.
  • Database links

  • Alternative names

    • Beta 3 endonexin antibody
    • Beta3 endonexin antibody
    • Beta3 endonexin long form antibody
    • CENP R antibody
    • CENPR antibody
    • CENPR_HUMAN antibody
    • Centromere protein R antibody
    • endonexin, Beta-3 antibody
    • HSU37139 antibody
    • Integrin beta 3 binding protein (beta3-endonexin) antibody
    • Integrin beta 3 binding protein antibody
    • NRIF 3 antibody
    • NRIF3 antibody
    • Nuclear receptor interacting factor 3 antibody
    • TAP 20 antibody
    • TAP20 antibody
    see all

References

ab192324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up