Overview

  • Product name

  • Description

    Rabbit polyclonal to ITGB6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Sheep, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human ITGB6 aa 131-371. N-terminal tag (Expressed in E.coli)
    Sequence:

    YPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQ KISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS KLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAV TQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEEL


    Database link: P18564

  • Positive control

    • WB: Pig skin lysate; Recombinant human ITGB6 protein. IHC-P: Human prostate, breast, pancreas and spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human spleen tissue stained for ITGB6 using ab233519 at 10 μg/ml in immunohistochemical analysis. AEC staining.

     

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for ITGB6 using ab233519 at 10 μg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded human breast tissue stained for ITGB6 using ab233519 at 10 μg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for ITGB6 using ab233519 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ITGB6 antibody (ab233519) at 2 µg/ml + Pig skin tissue lysate
  • Anti-ITGB6 antibody (ab233519) at 2 µg/ml + Recombinant human ITGB6 protein

References

This product has been referenced in:

  • Yu B  et al. Prediction of lymph node metastasis in oral squamous cell carcinoma based on protein profile. Expert Rev Proteomics 16:363-373 (2019). Read more (PubMed: 30779878) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up