Overview

  • Product name

    Anti-ITGB6 antibody [MM0780-61D9]
    See all ITGB6 primary antibodies
  • Description

    Mouse monoclonal [MM0780-61D9] to ITGB6
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, Flow Cyt, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Guinea pig, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ITGB6 aa 22-706.
    Sequence:

    GCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGCQ LNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTL QVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFR LGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAE RFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSD ADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQ NNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEEL RSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTV NIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGN GSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQ CICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCGECVCRSGWTG EYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCG DPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCS LQGENECLITFLITTDNEGKTIIHSINEKDCPKPP


    Database link: P18564

Properties

  • Form

    Lyophilised:Reconstitute the antibody with 500 µL sterile PBS.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    The IgG fraction of culture supernatant was purified by Protein G affinity chromatography and 0.2 µM filtered.
  • Clonality

    Monoclonal
  • Clone number

    MM0780-61D9
  • Isotype

    IgG2
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.
WB 1/1000 - 1/2000. Predicted molecular weight: 86 kDa.
ICC/IF 1/50 - 1/100.

Target

References

This product has been referenced in:

  • Cao D  et al. Retinoic Acid-Related Orphan Receptor C Regulates Proliferation, Glycolysis, and Chemoresistance via the PD-L1/ITGB6/STAT3 Signaling Axis in Bladder Cancer. Cancer Res 79:2604-2618 (2019). Read more (PubMed: 30808674) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up