Overview

  • Product name

  • Description

    Rabbit polyclonal to ITIH3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ITIH3 aa 354-518. (BC107604).
    Sequence:

    MEDKGMTNINDGLLRGISMLNKAREEHRIPERSTSIVIMLTDGDANVGES RPEKIQENVRNAIGGKFPLYNLGFGNNLNYNFLENMALENHGFARRIYED SDADLQLQGFYEEVANPLLTGVEMEYPENAILDLTQNTYQHFYDGSEIVV AGRLVDEDMNSFKAD


    Database link: Q06033

  • Positive control

    • Human fetal liver and fetal muscle lysates.

Properties

  • Form

    Lyophilised:Add 200 uL sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab197188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 100 kDa.

Target

  • Relevance

    The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. ITIH3 may act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • AW108094 antibody
    • H3P antibody
    • Inter alpha (globulin) inhibitor, H3 polypeptide antibody
    • Inter alpha inhibitor heavy chain 3 antibody
    • Inter alpha trypsin inhibitor heavy chain H3 antibody
    • Intin3 antibody
    • ITI HC3 antibody
    • ITI heavy chain H3 antibody
    • PAIHC3 antibody
    • Pre alpha-inhibitor, heavy chain 3 antibody
    • Serum derived hyaluronan-associated protein antibody
    • SHAP antibody
    see all

Images

  • All lanes : Anti-ITIH3 antibody (ab197188) at 1/500 dilution

    Lane 1 : Human fetal liver lysate
    Lane 2 : Human fetal muscle lysate

    Predicted band size: 100 kDa

References

ab197188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up