Overview

  • Product name

  • Description

    Rabbit polyclonal to ITIH4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment corresponding to Rat ITIH4 aa 478-722. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    TRYNFQHHFKGSEMVVAGKLRDQGPDVLLAKVSGQMHLQNITFQTEASIA QQEKEFQGPKYIFHNFMERLWALLTIQQQLEQRISASGAELEALEAQVLN LSLKYNFVTPLTHMVVTKPEDQEQFQVAEKPTEVDGGVWSILSAVQRHFK TPTTGSKLLTSRLRGNRFQTLSRLGDGLVGSRQYMPPPGLPGPPGLPGPP GPPGHPHFASSIDYGRQPSLGRVLDLPSLSSQDPAGPSLAMLPKV


    Database link: Q5EBC0

  • Positive control

    • WB: Recombinant rat ITIH4 protein; Rat lung lysate. IHC-P: Rat liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233227 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 104 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be involved in acute phase reactions.
  • Tissue specificity

    Liver specific.
  • Sequence similarities

    Belongs to the ITIH family.
    Contains 1 VIT domain.
    Contains 1 VWFA domain.
  • Post-translational
    modifications

    Cleaved by plasma kallikrein to yield 100 kDa and 35 kDa fragments, and the resulting 100 kDa fragment is further converted to a 70 kDa fragment.
    Appears to be both N- and O-glycosylated.
    The O-linked polysaccharides on Ser-696, Thr-701 and Ser-702 are probably the mucin type linked to GalNAc.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 35 kDa inter-alpha-trypsin inhibitor heavy chain H4 antibody
    • gp120 antibody
    • H4P antibody
    • IHRP antibody
    • Inter-alpha-inhibitor heavy chain 4 antibody
    • Inter-alpha-trypsin inhibitor family heavy chain-related protein antibody
    • Inter-alpha-trypsin inhibitor heavy chain H4 antibody
    • inter-alpha-trypsin inhibitor, heavy chain-like, 1 antibody
    • ITI heavy chain H4 antibody
    • ITI-HC4 antibody
    • ITIH4 antibody
    • ITIH4_HUMAN antibody
    • ITIHL1 antibody
    • OTTHUMP00000197120 antibody
    • OTTHUMP00000197121 antibody
    • OTTHUMP00000213834 antibody
    • OTTHUMP00000213869 antibody
    • PK-120 antibody
    • PK120 antibody
    • Plasma kallikrein sensitive glycoprotein 120 antibody
    • PRO1851 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for ITIH4 using ab233227 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ITIH4 antibody (ab233227) at 2 µg/ml + Recombinant rat ITIH4 protein

    Predicted band size: 104 kDa

  • Anti-ITIH4 antibody (ab233227) at 1 µg/ml + Rat lung lysate

    Predicted band size: 104 kDa

References

ab233227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up