Overview

  • Product name

  • Description

    Rabbit polyclonal to ITLN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human ITLN1 aa 31-253. Expressed in E. coli. N-terminal tag.
    Sequence:

    CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWT LVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAAT SDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLG HNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQRE FTAGFVQFRVFNNERAANALCAG


    Database link: Q8WWA0

  • Positive control

    • IHC-P: Human stomach and rectum tissue. WB: Recombinant human ITLN1 protein. Mouse lung tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May play a role in the defense system against microorganisms. May specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. May be involved in iron metabolism.
  • Tissue specificity

    Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Developmental stage

    Found in fetal small intestine and thymus.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Secreted. Enriched in lipid rafts.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endothelial lectin HL 1 antibody
    • Endothelial lectin HL-1 antibody
    • FLJ20022 antibody
    • Galactofuranose binding lectin antibody
    • Galactofuranose-binding lectin antibody
    • hIntL antibody
    • HL 1 antibody
    • HL-1 antibody
    • HL1 antibody
    • Intelectin antibody
    • Intelectin 1 antibody
    • Intelectin-1 antibody
    • Intestinal lactoferrin receptor antibody
    • INTL antibody
    • ITLN antibody
    • ITLN-1 antibody
    • ITLN1 antibody
    • ITLN1_HUMAN antibody
    • LFR antibody
    • Omentin antibody
    • OTTHUMP00000027882 antibody
    see all

Images

  • Anti-ITLN1 antibody (ab232885) at 3 µg/ml + Mouse lung tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human rectum tissue stained for ITLN1 with ab232885 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for ITLN1 with ab232885 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ITLN1 antibody (ab232885) at 2 µg/ml + Recombinant human ITLN1 protein

References

ab232885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up