Anti-ITPA antibody (ab244392)
Key features and details
- Rabbit polyclonal to ITPA
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ITPA antibody
See all ITPA primary antibodies -
Description
Rabbit polyclonal to ITPA -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ITPA aa 106-194.
Sequence:GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCF QPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
Database link: Q9BY32 -
Positive control
- ICC/IF: U-2 OS cells. WB: RT4 and U-251 MG cell lysate. Human tonsil tissue lysate. IHC-P: Human thyroid gland tissue.
-
General notes
This product was previously labelled as Inosine triphosphate pyrophosphatase
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244392 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Hydrolyzes ITP and dITP to their respective monophosphate derivatives. Xanthosine 5'-triphosphate (XTP) is also a potential substrate. May be the major enzyme responsible for regulating ITP concentration in cells. -
Tissue specificity
Ubiquitous. Highly expressed in heart, liver, sex glands, thyroid and adrenal gland. -
Involvement in disease
Defects in ITPA are the cause of inosine triphosphate pyrophosphohydrolase deficiency (ITPA deficiency) [MIM:147520]. It is a common inherited trait characterized by the abnormal accumulation of inosine triphosphate (ITP) in erythrocytes and also leukocytes and fibroblasts. The pathological consequences of ITPA deficiency, if any, are unknown. However, it might have pharmacogenomic implications and be related to increased drug toxicity of purine analog drugs. Three different human populations have been reported with respect to their ITPase activity: high, mean (25% of high) and low activity. The variant Thr-32 is associated with complete loss of enzyme activity, may be by altering the local secondary structure of the protein. Heterozygotes for this polymorphism have 22.5% of the control activity: this is consistent with a dimeric structure of the enzyme. -
Sequence similarities
Belongs to the HAM1 NTPase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 3704 Human
- Omim: 147520 Human
- SwissProt: Q9BY32 Human
- Unigene: 415299 Human
-
Alternative names
- C20orf37 antibody
- dJ794I6.3 antibody
- HLC14-06-P antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ITPA (green) using ab244392 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ITPA antibody (ab244392)
Paraffin-embedded human thyroid gland tissue stained for ITPA using ab244392 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-ITPA antibody (ab244392) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244392 has not yet been referenced specifically in any publications.