Overview

  • Product name

  • Description

    Rabbit polyclonal to ITPK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ITPK1 aa 185-414.
    Sequence:

    CVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHN VSKPESSSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIII NNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVA LLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKL PHQRLGCNAGVSPSFQHCVASLATKASSQ


    Database link: Q13572-1

  • Positive control

    • WB: HeLa, HepG2 and A431 whole cell lysate. IHC-P: Human liver and placenta tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway. Also acts as an inositol polyphosphate phosphatase that dephosphorylate Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 to Ins(1,3,4)P3, and Ins(1,3,4,5,6)P5 to Ins(3,4,5,6)P4. May also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. Probably acts as the rate-limiting enzyme of the InsP6 pathway. Modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.
  • Tissue specificity

    Expressed in brain > heart > skeletal muscle = kidney = pancreas = liver = placenta > lung. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal cord, occipital lobe, frontal lobe, temporal lobe and putamen.
  • Sequence similarities

    Belongs to the ITPK1 family.
    Contains 1 ATP-grasp domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 antibody
    • 4)P(3) 5/6-kinase antibody
    • 4-trisphosphate 5/6-kinase antibody
    • Inositol 1 3 4 triphosphate 5/6 kinase antibody
    • Inositol 1 3 4 trisphosphate 5/6 kinase antibody
    • Inositol 1 antibody
    • Inositol tetrakisphosphate 1 kinase antibody
    • Inositol triphosphate 5/6 kinase antibody
    • Inositol-tetrakisphosphate 1-kinase antibody
    • Inositol-triphosphate 5/6-kinase antibody
    • Ins(1 3 4)P(3) 5/6 kinase antibody
    • Ins(1 antibody
    • ITPK 1 antibody
    • itpk1 antibody
    • ITPK1_HUMAN antibody
    • ITRPK 1 antibody
    • ITRPK1 antibody
    see all

Images

  • All lanes : Anti-ITPK1 antibody (ab235353) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : A431 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human liver tissue stained for ITPK1 using ab235353 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for ITPK1 using ab235353 at 1/100 dilution in immunohistochemical analysis.

References

ab235353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up