Overview

  • Product name

  • Description

    Rabbit polyclonal to IWS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human IWS1 aa 570-819.
    Sequence:

    AAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEW LSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPK ESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMN STGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWN VEMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL


    Database link: Q96ST2

  • Positive control

    • WB: HeLa, HEK-293T and Jurkat whole cell lysates. IHC-P: Human liver and liver cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 92 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-IWS1 antibody (ab230183) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 92 kDa

  • Paraffin-embedded liver tissue stained for IWS1 using ab230183 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded liver cancer tissue stained for IWS1 using ab230183 at 1/100 dilution in immunohistochemical analysis.

References

ab230183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up