Overview

  • Product name

    Anti-IWS1 antibody - N-terminal
    See all IWS1 primary antibodies
  • Description

    Rabbit polyclonal to IWS1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Cow, Dog, Pig, Saccharomyces cerevisiae, Chimpanzee, Drosophila melanogaster, Rhesus monkey, Gorilla, Common marmoset, Orangutan, Bat
  • Immunogen

    Synthetic peptide within Human IWS1 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSE


    Database link: Q96ST2

  • Positive control

    • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH3T3 cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 92 kDa.

Target

Images

  • Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using NETN lysis buffer. Antibodies: ab195309 used for IP at 6 µg per reaction. For blotting immunoprecipitated IWS1, ab195309 was used at 0.4 µg/mL.

  • All lanes : Anti-IWS1 antibody - N-terminal (ab195309) at 0.4 µg/ml

    Lane 1 : HeLa cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : Mouse TCMK-1 cell lysate
    Lane 5 : Mouse NIH3T3 cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 92 kDa


    Exposure time: 30 seconds

References

ab195309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up