Overview

  • Product name

  • Description

    Rabbit polyclonal to Jagged1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Jagged1 aa 836-1047. (Expressed in E.coli).
    Sequence:

    VDEINGYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQC LNGRIACSKVWCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGE CRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRN LNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKI IDLVSKRDGNSS


    Database link: P78504

  • Positive control

    • WB: Recombinant human Jagged1 protein; HeLa and HEK-203T cell lysates; Pig and mouse liver lysates. IHC-P: Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 134 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation (By similarity). Enhances fibroblast growth factor-induced angiogenesis (in vitro).
  • Tissue specificity

    Widely expressed in adult and fetal tissues. In cervix epithelium expressed in undifferentiated subcolumnar reserve cells and squamous metaplasia. Expression is up-regulated in cervical squamous cell carcinoma. Expressed in bone marrow cell line HS-27a which supports the long-term maintenance of immature progenitor cells.
  • Involvement in disease

    Defects in JAG1 are the cause of Alagille syndrome type 1 (ALGS1) [MIM:118450]. Alagille syndrome is an autosomal dominant multisystem disorder defined clinically by hepatic bile duct paucity and cholestasis in association with cardiac, skeletal, and ophthalmologic manifestations. There are characteristic facial features and less frequent clinical involvement of the renal and vascular systems.
    Defects in JAG1 are a cause of tetralogy of Fallot (TOF) [MIM:187500]. TOF is a congenital heart anomaly which consists of pulmonary stenosis, ventricular septal defect, dextroposition of the aorta (aorta is on the right side instead of the left) and hypertrophy of the right ventricle. This condition results in a blue baby at birth due to inadequate oxygenation. Surgical correction is emergent.
  • Sequence similarities

    Contains 1 DSL domain.
    Contains 15 EGF-like domains.
  • Developmental stage

    Expressed in 32-52 days embryos in the distal cardiac outflow tract and pulmonary artery, major arteries, portal vein, optic vesicle, otocyst, branchial arches, metanephros, pancreas, mesocardium, around the major bronchial branches, and in the neural tube.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AGS antibody
    • AHD antibody
    • AWS antibody
    • CD 339 antibody
    • CD339 antibody
    • CD339 antigen antibody
    • Headturner antibody
    • hJ1 antibody
    • Htu antibody
    • Jag 1 antibody
    • Jag1 antibody
    • JAG1_HUMAN antibody
    • Jagged 1 antibody
    • Jagged1 (Alagille syndrome) antibody
    • Jagged1 antibody
    • JAGL1 antibody
    • MGC104644 antibody
    • OTTHUMP00000030278 antibody
    • Protein jagged-1 antibody
    • Ser 1 antibody
    • Ser1 antibody
    • Serrate 1 antibody
    • Slalom antibody
    see all

Images

  • Anti-Jagged1 antibody (ab233101) at 3 µg/ml + Recombinant human Jagged1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 134 kDa

  • All lanes : Anti-Jagged1 antibody (ab233101) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 3 : Pig liver lysate
    Lane 4 : Mouse liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 134 kDa

  • Paraffin-embedded human colon tissue stained for Jagged1 using ab233101 at 20 μg/ml in immunohistochemical analysis. AEC staining.

  • Paraffin-embedded human colon tissue stained for Jagged1 using ab233101 at 20 μg/ml in immunohistochemical analysis. AEC staining.

References

ab233101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up