Overview

  • Product name

  • Description

    Rabbit polyclonal to JAK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human JAK3 aa 610-660 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    MYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSA


    Database link: P52333

  • Positive control

    • Human lung carcinoma tissue; Mouse lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50-1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 125 kDa.

Target

  • Function

    Tyrosine kinase of the non-receptor type, involved in the interleukin-2 and interleukin-4 signaling pathway. Phosphorylates STAT6, IRS1, IRS2 and PI3K.
  • Tissue specificity

    In NK cells and an NK-like cell line but not in resting T-cells or in other tissues. The S-form is more commonly seen in hematopoietic lines, whereas the B-form is detected in cells both of hematopoietic and epithelial origins.
  • Involvement in disease

    Defects in JAK3 are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-negative (T(-)B(+)NK(-) SCID) [MIM:600802]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain

    Possesses two phosphotransferase domains. The second one probably contains the catalytic domain (By similarity), while the presence of slight differences suggest a different role for domain 1.
  • Post-translational
    modifications

    Tyrosine phosphorylated in response to IL-2 and IL-4.
  • Cellular localization

    Endomembrane system. Wholly intracellular, possibly membrane associated.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.10.2 antibody
    • JAK 3 antibody
    • JAK L antibody
    • JAK-3 antibody
    • Jak3 antibody
    • JAK3 HUMAN antibody
    • JAK3_HUMAN antibody
    • JAKL antibody
    • Janus kinase 3 (a protein tyrosine kinase, leukocyte) antibody
    • Janus kinase 3 antibody
    • Janus Kinase3 antibody
    • L JAK antibody
    • L-JAK antibody
    • Leukocyte janus kinase antibody
    • LJAK antibody
    • Protein tyrosine kinase leukocyte antibody
    • Tyrosine protein kinase JAK3 antibody
    • Tyrosine-protein kinase JAK3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin embedded human lung carcinoma tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.

References

This product has been referenced in:

  • Tan S  et al. Curculigoside exerts significant anti-arthritic effects in vivo and in vitro via regulation of the JAK/STAT/NF-?B signaling pathway. Mol Med Rep 19:2057-2064 (2019). Read more (PubMed: 30664158) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up