Anti-JAK3 antibody (ab203611)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-JAK3 antibody
See all JAK3 primary antibodies -
Description
Rabbit polyclonal to JAK3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human JAK3 aa 610-660 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:MYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSA
Database link: P52333 -
Positive control
- Human lung carcinoma tissue; Mouse lung tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab203611 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50-1/200. |
|
WB | 1/100 - 1/1000. Predicted molecular weight: 125 kDa. |
Target
-
Function
Tyrosine kinase of the non-receptor type, involved in the interleukin-2 and interleukin-4 signaling pathway. Phosphorylates STAT6, IRS1, IRS2 and PI3K. -
Tissue specificity
In NK cells and an NK-like cell line but not in resting T-cells or in other tissues. The S-form is more commonly seen in hematopoietic lines, whereas the B-form is detected in cells both of hematopoietic and epithelial origins. -
Involvement in disease
Defects in JAK3 are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-negative (T(-)B(+)NK(-) SCID) [MIM:600802]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
Contains 1 FERM domain.
Contains 1 protein kinase domain.
Contains 1 SH2 domain. -
Domain
Possesses two phosphotransferase domains. The second one probably contains the catalytic domain (By similarity), while the presence of slight differences suggest a different role for domain 1. -
Post-translational
modificationsTyrosine phosphorylated in response to IL-2 and IL-4. -
Cellular localization
Endomembrane system. Wholly intracellular, possibly membrane associated. - Information by UniProt
-
Database links
- Entrez Gene: 3718 Human
- Entrez Gene: 16453 Mouse
- Entrez Gene: 25326 Rat
- Omim: 600173 Human
- SwissProt: P52333 Human
- SwissProt: Q62137 Mouse
- SwissProt: Q63272 Rat
- Unigene: 515247 Human
see all -
Alternative names
- EC 2.7.10.2 antibody
- JAK 3 antibody
- JAK L antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-JAK3 antibody (ab203611)
Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-JAK3 antibody (ab203611)
Immunohistochemical analysis of formalin-fixed paraffin embedded human lung carcinoma tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.
Datasheets and documents
References
This product has been referenced in:
- Tan S et al. Curculigoside exerts significant anti-arthritic effects in vivo and in vitro via regulation of the JAK/STAT/NF-?B signaling pathway. Mol Med Rep 19:2057-2064 (2019). Read more (PubMed: 30664158) »