Anti-JAK3 antibody (ab203611)
Key features and details
- Rabbit polyclonal to JAK3
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-JAK3 antibody
See all JAK3 primary antibodies -
Description
Rabbit polyclonal to JAK3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human JAK3 aa 610-660 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:MYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSA
Database link: P52333 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab203611 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50-1/200. |
Target
-
Function
Tyrosine kinase of the non-receptor type, involved in the interleukin-2 and interleukin-4 signaling pathway. Phosphorylates STAT6, IRS1, IRS2 and PI3K. -
Tissue specificity
In NK cells and an NK-like cell line but not in resting T-cells or in other tissues. The S-form is more commonly seen in hematopoietic lines, whereas the B-form is detected in cells both of hematopoietic and epithelial origins. -
Involvement in disease
Defects in JAK3 are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-negative (T(-)B(+)NK(-) SCID) [MIM:600802]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
Contains 1 FERM domain.
Contains 1 protein kinase domain.
Contains 1 SH2 domain. -
Domain
Possesses two phosphotransferase domains. The second one probably contains the catalytic domain (By similarity), while the presence of slight differences suggest a different role for domain 1. -
Post-translational
modificationsTyrosine phosphorylated in response to IL-2 and IL-4. -
Cellular localization
Endomembrane system. Wholly intracellular, possibly membrane associated. - Information by UniProt
-
Database links
- Entrez Gene: 3718 Human
- Entrez Gene: 16453 Mouse
- Entrez Gene: 25326 Rat
- Omim: 600173 Human
- SwissProt: P52333 Human
- SwissProt: Q62137 Mouse
- SwissProt: Q63272 Rat
- Unigene: 515247 Human
see all -
Alternative names
- EC 2.7.10.2 antibody
- JAK 3 antibody
- JAK L antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-JAK3 antibody (ab203611)Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-JAK3 antibody (ab203611)Immunohistochemical analysis of formalin-fixed paraffin embedded human lung carcinoma tissue labeling Jak3 with ab203611 at 1/200 dilution. DAB staining.
Datasheets and documents
References (1)
ab203611 has been referenced in 1 publication.
- Tan S et al. Curculigoside exerts significant anti-arthritic effects in vivo and in vitro via regulation of the JAK/STAT/NF-?B signaling pathway. Mol Med Rep 19:2057-2064 (2019). PubMed: 30664158
