Overview

  • Product name

  • Description

    Rabbit polyclonal to JAM-C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human JAM-C aa 108-243.
    Sequence:

    RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMAT LHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFT AVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG


    Database link: Q9BX67

  • Positive control

    • WB: BEWO cell lysate. IHC-P: Human testis tissue. ICC/IF: U-251 MG cells.
  • General notes

    Previously labelled as Junctional Adhesion Molecule C.

Properties

Applications

Our Abpromise guarantee covers the use of ab224327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Participates in cell-cell adhesion. It is a counterreceptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN). The soluble form is a mediator of angiogenesis.
  • Tissue specificity

    Highest expression in placenta, brain and kidney. Significant expression is detected on platelets. Expressed in intestinal mucosa cells. Expressed in the vascular endothelium. Found in serum (at protein level). Also detected in the synovial fluid of patients with rheumatoid arthritis, psoriatic arthritis or ostearthritis (at protein level).
  • Involvement in disease

    Defects in JAM3 are the cause of hemorrhagic destruction of the brain with subependymal calcification and cataracts (HDBSCC) [MIM:613730]. A syndrome characterized by congenital cataracts and severe brain abnormalities apparently resulting from hemorrhagic destruction of the brain tissue, including the cerebral white matter and basal ganglia. Patients manifest profound developmental delay, and other neurologic features included seizures, spasticity, and hyperreflexia. Brain imaging shows multifocal intraparenchymal hemorrhage with associated liquefaction and massive cystic degeneration, and calcification in the subependymal region and in brain tissue.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Proteolytically cleaved from endothelial cells surface into a soluble form by ADAM10 and ADAM17; the release of soluble JAM3 is increased by proinflammatory factors.
  • Cellular localization

    Cell membrane. Cell junction > desmosome. Secreted > extracellular space. In epithelial cells, it is expressed at desmosomes but not at tight junctions. Localizes at the cell surface of endothelial cells; treatment of endothelial cells with vascular endothelial growth factor stimulates recruitement of JAM3 to cell-cell contacts.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ14529 antibody
    • JAM 2 antibody
    • JAM 3 antibody
    • JAM C antibody
    • JAM-2 antibody
    • JAM-3 antibody
    • JAM-C antibody
    • JAM2 antibody
    • Jam3 antibody
    • JAM3_HUMAN antibody
    • JAMC antibody
    • Junctional adhesion molecule 3 antibody
    • Junctional adhesion molecule 3 precursor antibody
    • Junctional adhesion molecule C antibody
    see all

Images

  • Anti-JAM-C antibody (ab224327) at 1/100 dilution + BEWO cell lysate

    Developed using the ECL technique.

    Predicted band size: 35 kDa

  • Paraffin-embedded human testis tissue stained for JAM-C using ab224327 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for JAM-C (green) using ab224327 at 4 µg/ml in ICC/IF.

References

ab224327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up