Anti-Jarid2 antibody (ab178561)
Key features and details
- Rabbit polyclonal to Jarid2
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Jarid2 antibody
See all Jarid2 primary antibodies -
Description
Rabbit polyclonal to Jarid2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human Jarid2 aa 1-100 (N terminal). The exact sequence is proprietary.
Sequence:MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNSQKRQHAE GIAGSLKTVNGLLGNDQSKGLGPASEQSENEKDDASQVSSTSNDVSSSDF
Database link: Q92833 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.88% Sodium chloride, 99% Tris glycine -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab178561 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 2 µg/ml. Predicted molecular weight: 138 kDa.
|
|
ICC/IF |
1/50 - 1/200.
|
Notes |
---|
WB
Use a concentration of 2 µg/ml. Predicted molecular weight: 138 kDa. |
ICC/IF
1/50 - 1/200. |
Target
-
Function
Regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis. Acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes. Binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells. Does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases. Also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5. Participates in the negative regulation of cell proliferation signaling. -
Tissue specificity
During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells. -
Sequence similarities
Contains 1 ARID domain.
Contains 1 JmjC domain.
Contains 1 JmjN domain. -
Domain
The ARID domain is required to target the PRC2 complex to its target genes.
The GSGFP motif is required for the interaction with SUZ12. -
Cellular localization
Nucleus. Colocalizes with the PRC2 complex on chromatin. - Information by UniProt
-
Database links
- Entrez Gene: 3720 Human
- Entrez Gene: 16468 Mouse
- Omim: 601594 Human
- SwissProt: Q92833 Human
- SwissProt: Q62315 Mouse
- Unigene: 269059 Human
- Unigene: 25059 Mouse
-
Alternative names
- JARD2 antibody
- JARD2_HUMAN antibody
- JARID2 antibody
see all
Images
-
Anti-Jarid2 antibody (ab178561) at 2 µg/ml + E16 mouse brain lysate
Predicted band size: 138 kDa -
Immunofluorescent analysis of HeLa cells labeling Jarid2 with ab178561 at 1/50 dilution, using a DyLight 488 conjugated secondary antibody.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab178561 has been referenced in 2 publications.
- Wang X et al. Jarid2 enhances the progression of bladder cancer through regulating PTEN/AKT signaling. Life Sci 230:162-168 (2019). PubMed: 31125562
- Dahle Ø & Kuehn MR Inhibiting Smad2/3 signaling in pluripotent mouse embryonic stem cells enhances endoderm formation by increasing transcriptional priming of lineage-specifying target genes. Dev Dyn 245:807-15 (2016). PubMed: 27012147