Anti-Jarid2 antibody (ab178561)

Submit a review Submit a question References (1)

Overview

  • Product name

    Anti-Jarid2 antibody
    See all Jarid2 primary antibodies

  • Description

    Rabbit polyclonal to Jarid2

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ChIP, ICC/IFmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Synthetic peptide within Human Jarid2 aa 1-100 (N terminal). The exact sequence is proprietary.
    Sequence:

    MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNSQKRQHAE GIAGSLKTVNGLLGNDQSKGLGPASEQSENEKDDASQVSSTSNDVSSSDF


    Database link: Q92833

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • E16 mouse brain lysate; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab178561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 138 kDa.
ChIP Use at an assay dependent concentration.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis. Acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes. Binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells. Does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases. Also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5. Participates in the negative regulation of cell proliferation signaling.

  • Tissue specificity

    During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells.

  • Sequence similarities

    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.

  • Domain

    The ARID domain is required to target the PRC2 complex to its target genes.
    The GSGFP motif is required for the interaction with SUZ12.

  • Cellular localization

    Nucleus. Colocalizes with the PRC2 complex on chromatin.
  • Information by UniProt

  • Database links

    • Alternative names

      • JARD2 antibody
      • JARD2_HUMAN antibody
      • JARID2 antibody
      • JMJ antibody
      • Jumonji AT rich interactive domain 2 antibody
      • Jumonji homolog antibody
      • Jumonji like protein antibody
      • Jumonji protein antibody
      • Jumonji/ARID domain containing protein 2 antibody
      • Jumonji/ARID domain-containing protein 2 antibody
      • Protein Jumonji antibody
      see all

    Images

    • Western blot - Anti-Jarid2 antibody (ab178561)
      Western blot - Anti-Jarid2 antibody (ab178561)
      Anti-Jarid2 antibody (ab178561) at 2 µg/ml + E16 mouse brain lysate

      Predicted band size: 138 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-Jarid2 antibody (ab178561)
      Immunocytochemistry/ Immunofluorescence - Anti-Jarid2 antibody (ab178561)

      Immunofluorescent analysis of HeLa cells labeling Jarid2 with ab178561 at 1/50 dilution, using a DyLight 488 conjugated secondary antibody.

    References

    This product has been referenced in:

    • Dahle Ø & Kuehn MR Inhibiting Smad2/3 signaling in pluripotent mouse embryonic stem cells enhances endoderm formation by increasing transcriptional priming of lineage-specifying target genes. Dev Dyn 245:807-15 (2016). Read more (PubMed: 27012147) »
    See 1 Publication for this product

    Publishing research using ab178561? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab178561.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com