Overview

  • Product name

    Anti-JAZF1 antibody
  • Description

    Rabbit polyclonal to JAZF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish, Orangutan
  • Immunogen

    Synthetic peptide within Human JAZF1 aa 181-230 (C terminal). The exact sequence is proprietary.
    Sequence:

    KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH


    Database link: Q86VZ6

  • Positive control

    • Jurkat nuclear lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab80329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Potential transcription factor.
  • Involvement in disease

    Note=A chromosomal aberration involving JAZF1 may be a cause of endometrial stromal tumors. Translocation t(7;17)(p15;q21) with SUZ12. The translocation generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.
  • Sequence similarities

    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • JAZF zinc finger 1 antibody
    • JAZF1 antibody
    • JAZF1_HUMAN antibody
    • Juxtaposed with another zinc finger protein 1 antibody
    • TAK1 interacting protein 27 antibody
    • TAK1-interacting protein 27 antibody
    • TIP27 antibody
    • Zinc finger protein 802 antibody
    • ZNF802 antibody
    see all

Images

  • Anti-JAZF1 antibody (ab80329) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling JAZF1 with ab80329 at 5.0µg/ml.

References

This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up